PDB entry 2cmu

View 2cmu on RCSB PDB site
Description: Crystal structure of a putative peptidyl-arginine deiminase
Class: hydrolase
Keywords: hydrolase, peptidyl-arginine deiminase, t1664, jhp0042, unknown function, structural genomics, hypothetical protein, new york structural genomix research consortium, psi, protein structure initiative, nysgxrc
Deposited on 2006-05-13, released 2006-05-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative peptidyl-arginine deiminase
    Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CMU (332-End)
      • conflict (2)
      • conflict (64)
      • conflict (75-76)
      • conflict (91)
      • conflict (139)
      • conflict (153)
      • conflict (176)
      • conflict (220)
      • conflict (224)
      • conflict (247)
      • conflict (281)
    • Uniprot O24890 (2-331)
    Domains in SCOPe 2.08: d2cmua1, d2cmua2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cmuA (A:)
    mslkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndt
    igyemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv
    nfklkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlk
    kelgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeel
    ktfkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdalilet
    lkqhtplevigvdcntlikqhgslhcvtmqlyeggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cmuA (A:)
    mslkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndt
    igyemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqv
    nfklkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlk
    kelgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeel
    ktfkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdalilet
    lkqhtplevigvdcntlikqhgslhcvtmqlyegg