PDB entry 2cmr

View 2cmr on RCSB PDB site
Description: crystal structure of the hiv-1 neutralizing antibody d5 fab bound to the gp41 inner-core mimetic 5-helix
Class: immune system
Keywords: immune system, immunoglobulin complex, neutralization, immunoglobulin, envelope protein, hiv, gp41, aids, MHC I, membrane, transmembrane, immunoglobulin domain
Deposited on 2006-05-11, released 2006-10-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transmembrane glycoprotein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CMR (0-206)
    • Uniprot P04578 (177-End)
  • Chain 'H':
    Compound: d5
    Species: Homo sapiens [TaxId:9606]
  • Chain 'L':
    Compound: d5
    Species: Homo sapiens [TaxId:9606]
    Domains in SCOPe 2.05: d2cmrl1, d2cmrl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2cmrL (L:)
diqmtqspstlsasigdrvtitcrasegiyhwlawyqqkpgkapklliykasslasgaps
rfsgsgsgtdftltisslqpddfatyycqqysnypltfgggtkleikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtks