PDB entry 2cml

View 2cml on RCSB PDB site
Description: structure of neuraminidase from english duck subtype n6 complexed with 30 mm zanamivir, crystal soaked for 3 hours at 291 k.
Class: hydrolase
Keywords: hb site, hydrolase, subtype n6, glycosidase, influenza type a, sialic acid, neuraminidase, transmembrane
Deposited on 2006-05-10, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmla_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmlb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmlc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2cmld_
  • Heterogens: ZMR, CA, NAG, MAN, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmlA (A:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmlB (B:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmlC (C:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmlD (D:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe