PDB entry 2cmk

View 2cmk on RCSB PDB site
Description: cytidine monophosphate kinase in complex with cytidine-di-phosphate
Class: transferase
Keywords: nucleotide monophosphate kinase, transferase
Deposited on 1998-09-19, released 1999-09-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytidine monophosphate kinase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2cmka_
  • Heterogens: SO4, CDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cmkA (A:)
    mtaiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedal
    vplashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqraf
    relpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeike
    rddrdrnravaplvpaadalvldsttlsieqviekalqyarqklala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cmkA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqk