PDB entry 2cmk

View 2cmk on RCSB PDB site
Description: cytidine monophosphate kinase in complex with cytidine-di-phosphate
Deposited on 1998-09-19, released 1999-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-20, with a file datestamp of 1999-09-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d2cmka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmkA (A:)
    aiapvitidgpsgagkgtlckamaealqwhlldsgaiyrvlalaalhhhvdvasedalvp
    lashldvrfvstngnlevilegedvsgeirtqevanaasqvaafprvreallrrqrafre
    lpgliadgrdmgtvvfpdapvkifldasseerahrrmlqlqekgfsvnferllaeikerd
    drdrnravaplvpaadalvldsttlsieqviekalqyarqk