PDB entry 2cmj

View 2cmj on RCSB PDB site
Description: crystal structure of mouse cytosolic isocitrate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, tricarboxylic acid cycle, isocitrate dehydrogenase, nadp, glyoxylate bypass
Deposited on 2006-05-10, released 2007-05-29
Made obsolete by 5yzh on 2018-06-27

The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2cmja_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2cmjb_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cmjA (A:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cmjB (B:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cmjB (B:)
    kiqggsvvemqgdemtriiwelikeklilpyveldlhsydlgienrdatndqvtkdaaea
    ikkynvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvtg
    wvkpiiigrhaygdqyratdfvvpgpgkveitytpkdgtqkvtymvhdfeegggvamgmy
    nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkkyksqfeaqn
    icyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlicpdgktv
    eaeaahgtvtrhyrmyqkgqetstnpiasifawsrglahrakldnntelsffakaledvc
    ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkaklaqa