PDB entry 2cm6

View 2cm6 on RCSB PDB site
Description: crystal structure of the c2b domain of rabphilin3a
Class: protein transport
Keywords: protein transport, zinc-finger, rabphilin3a, ca2+ binding, metal-binding, synaptic exocytosis, c2a-c2b linker fragment, c2b, zinc, synapse, c2 domain, transport
Deposited on 2006-05-04, released 2006-12-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.1979
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cm6a_
  • Chain 'B':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cm6b_
  • Heterogens: CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cm6A (A:)
    gsargmalyeeeqverigdieergkilvslmystqqgglivgiircvhlaamdangysdp
    fvklwlkpdmgkkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksn
    dyiggcqlgisakgerlkhwyeclknkdkkierwhqlqnenhvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cm6A (A:)
    malyeeeqverieergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkp
    kkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgis
    akgerlkhwyeclknkdkkierwhqlqne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cm6B (B:)
    gsargmalyeeeqverigdieergkilvslmystqqgglivgiircvhlaamdangysdp
    fvklwlkpdmgkkakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksn
    dyiggcqlgisakgerlkhwyeclknkdkkierwhqlqnenhvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cm6B (B:)
    alyeeeqveergkilvslmystqqgglivgiircvhlaamdangysdpfvklwlkpdmgk
    kakhktqikkktlnpefneeffydikhsdlakksldisvwdydigksndyiggcqlgisa
    kgerlkhwyeclknkdkkierwhqlqne