PDB entry 2cm0

View 2cm0 on RCSB PDB site
Description: the pub domain functions as a p97 binding module in human peptide n-glycanase.
Class: transferase
Keywords: transferase, kinase, pug domain
Deposited on 2006-05-03, released 2006-06-28
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.1851
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptide n-glycanase homolog
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96IV0 (0-98)
    • engineered mutation (30)
    • engineered mutation (39-40)
  Domains in SCOP 1.73: d2cm0a1
• Heterogens: BME, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cm0A (A:)
  gsaspavaelcqntpetfleaskllltyadailrnpndeaarsirigntafstrllpvrg
  aveclfemgfeegethlifpkkasveqlqkirdliaier