PDB entry 2clw

View 2clw on RCSB PDB site
Description: crystal structure of human ubiquitin-conjugating enzyme ubch5b
Class: ligase
Keywords: ligase, ubl conjugation pathway, ubiquitin-conjugating enzyme, ubc domain, ec 6.3.2.19, thioesterification
Deposited on 2006-05-02, released 2007-06-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.218
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2CLW (Start-17)
    • Uniprot P62837 (18-164)
    Domains in SCOPe 2.01: d2clwa_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.01: d2clwb_
  • Chain 'C':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.01: d2clwc_
  • Chain 'D':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.01: d2clwd_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2clwA (A:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clwA (A:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2clwB (B:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clwB (B:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2clwC (C:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clwC (C:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2clwD (D:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2clwD (D:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam