PDB entry 2clc

View 2clc on RCSB PDB site
Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with GTP (2)
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein, golgi apparatus, proto-oncogene, r-caged GTP, prenylation, lipoprotein, GTP-binding, palmitate, methylation
Deposited on 2006-04-27, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: gtpase hras
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01112 (0-165)
    • engineered mutation (31)
    • engineered mutation (117)
  Domains in SCOPe 2.07: d2clcx_
• Heterogens: MG, XY2, GTP, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2clcX (X:)
  mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
  qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
  aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh