PDB entry 2cla

View 2cla on RCSB PDB site
Description: crystal structure of the asp-199-asn mutant of chloramphenicol acetyltransferase to 2.35 angstroms resolution. structural consequences of disruption of a buried salt-bridge
Class: transferase (acyltransferase)
Keywords: transferase (acyltransferase)
Deposited on 1990-04-05, released 1990-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.152
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloramphenicol acetyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00484 (0-212)
      • conflict (192)
    Domains in SCOPe 2.06: d2claa_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2claA (A:)
mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
avnqfdelrmaikddelivwdsvdpqftvfhqetetfsalscpyssdidqfmvnylsvme
ryksdtklfpqgvtpenhlnisalpwvnfdsfnlnvanftdyfapiitmakyqqegdrll
lplsvqvhhavcngfhvarfinrlqelcnsklk