PDB entry 2cl7

View 2cl7 on RCSB PDB site
Description: crystal structure analysis of a fluorescent form of h-ras p21 in complex with GTP
Class: nucleotide-binding protein
Keywords: nucleotide-binding protein, proto-oncogene, r-caged GTP, prenylation, lipoprotein, GTP-binding, palmitate
Deposited on 2006-04-26, released 2006-05-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.149
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: gtpase hras
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01112 (0-165)
      • engineered mutation (31)
      • engineered mutation (117)
    Domains in SCOPe 2.01: d2cl7x_
  • Heterogens: MG, XY2, GTP

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cl7X (X:)
    mteyklvvvgaggvgksaltiqliqnhfvdecdptiedsyrkqvvidgetclldildtag
    qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnksdl
    aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh