PDB entry 2ckx

View 2ckx on RCSB PDB site
Description: crystal structure of ngtrf1, double-stranded telomeric repeat binding factor from nicotiana tabacum.
Class: nuclear protein
Keywords: nuclear protein
Deposited on 2006-04-24, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2101
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: telomere binding protein tbp1
  Species: NICOTIANA TABACUM [TaxId:4097]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q84ZU4 (0-82)
  Domains in SCOPe 2.08: d2ckxa1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ckxA (A:)
  rpfsvaevealveavehlgtgrwrdvkmrafdnadhrtyvdlkdkwktlvhtasiapqqr
  rgepvpqdlldrvlaahaywsqq