PDB entry 2ckh

View 2ckh on RCSB PDB site
Description: senp1-sumo2 complex
Class: hydrolase
Keywords: ubl conjugation pathway, nuclear protein, protease co- complex, sumo, protease, hydrolase, thiol protease
Deposited on 2006-04-18, released 2006-04-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.248
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sentrin-specific protease 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ckha1
  • Chain 'B':
    Compound: Small ubiquitin-related modifier 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2ckhb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ckhA (A:)
    efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnml
    merskekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclav
    vdfrkknityydsmgginneacrillqylkqesidkkrkefdtngwqlfskksqipqqmn
    gsdcgmfackyadcitkdrpinftqqhmpyfrkrmvweilhrkll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ckhB (B:)
    ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
    qlemededtidvfqqqtgg