PDB entry 2ckd

View 2ckd on RCSB PDB site
Description: crystal structure of ml2640 from mycobacterium leprae
Class: transferase
Keywords: transferase
Deposited on 2006-04-17, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative s-adenosyl-l-methionine-dependent methyltransferase ml2640
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ckda1
  • Chain 'B':
    Compound: putative s-adenosyl-l-methionine-dependent methyltransferase ml2640
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ckdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ckdA (A:)
    mrthddtwdiktsvgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldp
    smvakveaidaeaaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrl
    dwptgttvyeidqpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsar
    tawlaegllmylpataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsda
    lgfeqavdvqeliyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkda
    faefvtahrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckdA (A:)
    wdiktsvgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakve
    aidaeaaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgtt
    vyeidqpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaeg
    llmylpataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqav
    dvqeliyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvta
    hrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ckdB (B:)
    mrthddtwdiktsvgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldp
    smvakveaidaeaaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrl
    dwptgttvyeidqpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsar
    tawlaegllmylpataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsda
    lgfeqavdvqeliyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkda
    faefvtahrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ckdB (B:)
    svgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsmvakveaidae
    aaamvehmrsyqavrtnffdtyfnnavidgirqfvilasgldsrayrldwptgttvyeid
    qpkvlayksttlaehgvtptadrrevpidlrqdwppalrsagfdpsartawlaegllmyl
    pataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqavdvqel
    iyhdenravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvtahrl