PDB entry 2ck9

View 2ck9 on RCSB PDB site
Description: structural evidence for ammonia tunneling across the (beta-alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex
Class: lyase/transferase
Keywords: histidine biosynthesis pathway, imidazole glycerol phosphate synthase, ammonia tunneling, amino-acid biosynthesis, histidine biosynthesis, lyase, glutamine amidotransferase, transferase, lyase/transferase
Deposited on 2006-04-13, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-06-12, with a file datestamp of 2007-06-08.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.1855
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazole glycerol phosphate synthase subunit hisF
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C6 (0-252)
      • conflict (10)
    Domains in SCOPe 2.07: d2ck9a_
  • Chain 'B':
    Compound: imidazole glycerol phosphate synthase subunit hish
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ck9b_
  • Chain 'C':
    Compound: Imidazole glycerol phosphate synthase subunit hisF
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C6 (0-252)
      • conflict (10)
    Domains in SCOPe 2.07: d2ck9c_
  • Chain 'D':
    Compound: imidazole glycerol phosphate synthase subunit hish
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ck9d_
  • Chain 'E':
    Compound: Imidazole glycerol phosphate synthase subunit hisF
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0C6 (0-252)
      • conflict (10)
    Domains in SCOPe 2.07: d2ck9e_
  • Chain 'F':
    Compound: imidazole glycerol phosphate synthase subunit hish
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ck9f_
  • Heterogens: AMZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9A (A:)
    mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
    tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
    gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
    gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
    lkkhgvnvrlegl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9B (B:)
    mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
    lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
    mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
    ksskigrkllekviecslsrr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9C (C:)
    mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
    tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
    gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
    gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
    lkkhgvnvrlegl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9D (D:)
    mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
    lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
    mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
    ksskigrkllekviecslsrr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9E (E:)
    mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
    tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
    gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
    gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
    lkkhgvnvrlegl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck9F (F:)
    mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
    lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
    mgwnevifkdtfpngyyyfvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
    ksskigrkllekviecslsrr