PDB entry 2ck2

View 2ck2 on RCSB PDB site
Description: Structure of core-swapped mutant of fibronectin
Class: signaling protein
Keywords: sulfation, acute phase, glycoprotein, cell adhesion, pyrrolidone carboxylic acid, heparin-binding, phosphorylation, signaling protein
Deposited on 2006-04-10, released 2007-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02751 (0-95)
      • engineered mutation (7)
      • engineered mutation (12)
      • engineered mutation (17)
      • engineered mutation (28)
      • engineered mutation (31)
      • engineered mutation (33)
      • engineered mutation (47)
      • engineered mutation (49)
      • engineered mutation (56)
      • engineered mutation (65)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (87)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d2ck2a_
  • Chain 'B':
    Compound: human fibronectin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02751 (0-95)
      • engineered mutation (7)
      • engineered mutation (12)
      • engineered mutation (17)
      • engineered mutation (28)
      • engineered mutation (31)
      • engineered mutation (33)
      • engineered mutation (47)
      • engineered mutation (49)
      • engineered mutation (56)
      • engineered mutation (65)
      • engineered mutation (71)
      • engineered mutation (73)
      • engineered mutation (87)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d2ck2b_
  • Heterogens: ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ck2A (A:)
    vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
    glkpgtdytvtlysvtgrgdspasskpasinfrtei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ck2A (A:)
    vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
    glkpgtdytvtlysvtgrgpasskpasinfrtei
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ck2B (B:)
    vsdvprdievvavtptsaliswdapavtiryirltygetggnspvqeitlpgskstytis
    glkpgtdytvtlysvtgrgdspasskpasinfrtei