PDB entry 2cjs

View 2cjs on RCSB PDB site
Description: Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch: C2-domains as Versatile Protein-Protein Interaction Modules
Class: exocytosis
Keywords: neurotransmitter transport, exocytosis, zinc finger, synaptosome, phorbol-ester binding, neurotransmitter release, metal-binding, protein- protein interactions, rim, munc13, synapse, transport, c2 domains
Deposited on 2006-04-06, released 2006-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.7800000000000002 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unc-13 homolog a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJS (162-End)
      • engineered mutation (43)
    • Uniprot Q62768 (13-161)
    Domains in SCOPe 2.08: d2cjsa1, d2cjsa2
  • Chain 'B':
    Compound: unc-13 homolog a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJS (162-166)
      • engineered mutation (43)
    • Uniprot Q62768 (13-161)
    Domains in SCOPe 2.08: d2cjsb2, d2cjsb3
  • Chain 'C':
    Compound: Regulating synaptic membrane exocytosis protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJS
    • Uniprot Q9JIS1 (Start-61)
  • Heterogens: EDO, GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cjsA (A:)
    gspgisgggggilsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqd
    fmfeinrldlgltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimads
    eicgtkdptfhrilldahfelpldipeeearywakkleqlnaklnss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjsA (A:)
    gisgggggilsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmf
    einrldlgltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseic
    gtkdptfhrilldahfelpldipeeearywakkleqlnaklns
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cjsB (B:)
    gspgisgggggilsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqd
    fmfeinrldlgltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimads
    eicgtkdptfhrilldahfelpldipeeearywakkleqlnaklnss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjsB (B:)
    ilsllcvgvkkakfdgaqekfntyvtlkvqnvesttiavrgsqpsweqdfmfeinrldlg
    ltvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfh
    rilldahfelpldipeeearywakkleqlnaklnss
    

  • Chain 'C':
    No sequence available.