PDB entry 2cjl

View 2cjl on RCSB PDB site
Description: crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences with plant enzymes
Class: hydrolase
Keywords: hydrolase, plant enzymes
Deposited on 2006-04-04, released 2006-10-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.188
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: secreted chitinase
    Species: STREPTOMYCES COELICOLOR [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjla_
  • Chain 'B':
    Compound: secreted chitinase
    Species: STREPTOMYCES COELICOLOR [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjlb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjlA (A:)
    fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg
    lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp
    dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv
    qsridnyerftqllgvepggnlsc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cjlB (B:)
    fvvseaqfdqmfpsrnsfytysgltaalsaypgfsntgsdtvkkqeaaaflanvghetgg
    lvyvveqntanyphycdasqpygcpagndkyygrgpvqlswnfnykaagdalgidllnnp
    dlvqndsavawktglwywntqtgpgtmtphdamvngagfgetirsingslecdggnpgqv
    qsridnyerftqllgvepggnlsc