PDB entry 2cjf

View 2cjf on RCSB PDB site
Description: type II dehydroquinase inhibitor complex
Class: lyase
Keywords: dehydroquinase, shikimate pathway, dehydroquinate, drug design, lyase, amino-acid biosynthesis, aromatic amino acid biosynthesis
Deposited on 2006-03-31, released 2007-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfa_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfe_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjff_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfh_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfi_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Streptomyces coelicolor [TaxId:1902]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cjfl_
  • Heterogens: RP4, GOL, PO4, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cjfA (A:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfA (A:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cjfB (B:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfB (B:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cjfC (C:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfC (C:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cjfD (D:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfD (D:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2cjfE (E:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfE (E:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2cjfF (F:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfF (F:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2cjfG (G:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfG (G:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2cjfH (H:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfH (H:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2cjfI (I:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfI (I:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2cjfJ (J:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfJ (J:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2cjfK (K:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfK (K:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2cjfL (L:)
    mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
    gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
    syvsqradgvvagcgvqgyvfgveriaalagagsara
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cjfL (L:)
    rslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhege
    lvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhhsy
    vsqradgvvagcgvqgyvfgveriaalag