PDB entry 2cj7

View 2cj7 on RCSB PDB site
Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.0)
Class: inhibitor
Keywords: inhibitor, protein binding, four-helix bundle, helical hairpin
Deposited on 2006-03-29, released 2006-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJ7
    • Uniprot O49908 (3-149)
    Domains in SCOPe 2.08: d2cj7a_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cj7A (A:)
    gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
    rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
    fkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cj7A (A:)
    nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
    nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfks
    pfsalniavhelsdvgraivrnll