PDB entry 2cj6

View 2cj6 on RCSB PDB site
Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 7.5)
Class: inhibitor
Keywords: protein binding, four-helix bundle, helical hairpin, inhibitor
Deposited on 2006-03-29, released 2006-03-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22002
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cj6a1
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cj6A (A:)
    gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
    rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
    fkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cj6A (A:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll