PDB entry 2cj6

View 2cj6 on RCSB PDB site
Description: Crystal Structure of a Cell Wall Invertase Inhibitor from Tobacco (pH 7.5)
Class: inhibitor
Keywords: inhibitor, protein binding, four-helix bundle, helical hairpin
Deposited on 2006-03-29, released 2006-03-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJ6
    • Uniprot O49908 (Start-149)
    Domains in SCOPe 2.08: d2cj6a_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cj6A (A:)
    gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
    rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
    fkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cj6A (A:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll