PDB entry 2cj5

View 2cj5 on RCSB PDB site
Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0)
Class: inhibitor
Keywords: inhibitor, protein binding, four-helix bundle, helical hairpin
Deposited on 2006-03-29, released 2006-03-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.182
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum [TaxId:4097]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CJ5
    • Uniprot O49908 (3-149)
    Domains in SCOPe 2.01: d2cj5a_
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2cj5A (A:)
gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
fkgskspfsalniavhelsdvgraivrnll

    Sequence, based on observed residues (ATOM records): (download) 
    >2cj5A (A:)
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll