PDB entry 2cj4

View 2cj4 on RCSB PDB site
Description: crystal structure of a cell wall invertase inhibitor from tobacco at ph 4.6
Class: inhibitor
Keywords: protein binding, four-helix bundle, helical hairpin, inhibitor
Deposited on 2006-03-29, released 2006-03-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-17, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.15274
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cj4a1
  • Chain 'B':
    Compound: invertase inhibitor
    Species: Nicotiana tabacum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cj4b1
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cj4A (A:)
    gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
    rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
    fkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cj4A (A:)
    nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
    nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
    skspfsalniavhelsdvgraivrnll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cj4B (B:)
    gamnnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtiskl
    rhsnppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceey
    fkgskspfsalniavhelsdvgraivrnll
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cj4B (B:)
    nlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhsn
    ppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkgs
    kspfsalniavhelsdvgraivrnll