PDB entry 2cj3

View 2cj3 on RCSB PDB site
Description: crystal structure of plastocyanin from a cyanobacterium, anabaena variabilis
Class: electron transport
Keywords: copper, transport, beta barrel, plastocyanin, metal-binding, electron transport
Deposited on 2006-03-27, released 2007-04-03
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.141
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plastocyanin
    Species: ANABAENA SP.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cj3a1
  • Chain 'B':
    Compound: plastocyanin
    Species: ANABAENA SP.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2cj3b1
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cj3A (A:)
    etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
    hkqllmspgqststtfpadapageytfycephrgagmvgkitvag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cj3B (B:)
    etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
    hkqllmspgqststtfpadapageytfycephrgagmvgkitvag