PDB entry 2cj1

View 2cj1 on RCSB PDB site
Description: chloroperoxidase complexed with formate (ethylene glycol cryoprotectant)
Class: oxidoreductase
Keywords: oxidoreductase, heme, iron, chloride, manganese, peroxidase, pyrrolidone carboxylic acid, glycoprotein, metal-binding
Deposited on 2006-03-26, released 2006-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: CALDARIOMYCES FUMAGO [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2cj1a1, d2cj1a2
  • Heterogens: MN, HEM, NAG, MAN, EDO, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cj1A (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd