PDB entry 2ciy

View 2ciy on RCSB PDB site
Description: chloroperoxidase complexed with cyanide and dmso
Class: oxidoreductase
Keywords: oxidoreductase, heme, iron, chloride, manganese, peroxidase, pyrrolidone carboxylic acid, glycoprotein, metal-binding
Deposited on 2006-03-26, released 2006-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: CALDARIOMYCES FUMAGO [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ciya1, d2ciya2
  • Heterogens: MN, HEM, NAG, MAN, BR, EDO, CYN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ciyA (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd