PDB entry 2ciw

View 2ciw on RCSB PDB site
Description: chloroperoxidase iodide complex
Class: oxidoreductase
Keywords: heme, iron, chloride, manganese, peroxidase, pyrrolidone carboxylic acid, glycoprotein, metal-binding, oxidoreductase
Deposited on 2006-03-26, released 2006-06-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-16, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.14968
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: Caldariomyces fumago
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ciwa1, d2ciwa2
  • Heterogens: NAG, MAN, MN, IOD, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ciwA (A:)
    eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
    hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
    nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
    qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
    assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd