PDB entry 2ciw

View 2ciw on RCSB PDB site
Description: Chloroperoxidase iodide complex
Class: oxidoreductase
Keywords: oxidoreductase, heme, iron, chloride, manganese, peroxidase, pyrrolidone carboxylic acid, glycoprotein, metal-binding
Deposited on 2006-03-26, released 2006-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloroperoxidase
    Species: CALDARIOMYCES FUMAGO [TaxId:5474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ciwa1, d2ciwa2
  • Heterogens: MN, HEM, NAG, MAN, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ciwA (A:)
eepgsgigypydnntlpyvapgptdsrapcpalnalanhgyiphdgraisretlqnafln
hmgiansvielaltnafvvceyvtgsdcgdslvnltllaephafehdhsfsrkdykqgva
nsndfidnrnfdaetfqtsldvvagkthfdyadmneirlqreslsneldfpgwfteskpi
qnvesgfifalvsdfnlpdndenplvridwwkywftnesfpyhlgwhppspareiefvts
assavlaasvtstpsslpsgaigpgaeavplsfastmtpfllatnapyyaqdptlgpnd