PDB entry 2cit

View 2cit on RCSB PDB site
Description: Structure of the covalent intermediate of a family 26 lichenase
Class: hydrolase
Keywords: lichenase, hydrolase, glycosidase, polysaccharide degradation, cellulose degradation, carbohydrate metabolism, michaelis complex, glycoside hydrolase
Deposited on 2006-03-24, released 2006-04-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase h
    Species: CLOSTRIDIUM THERMOCELLUM [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CIT
      • engineered mutation (108)
    • Uniprot P16218 (Start-281)
    Domains in SCOPe 2.08: d2cita1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2citA (A:)
    masnynsglkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavyn
    ngsilmitwepweyntvdikngkadayitrmaqdmkaygkeiwlrplhaangdwypwaig
    yssrvntnetyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdyt
    sidgynwgttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteay
    nsirtsynkviaavwfhenketdwrinsspealaayreaiga
    

    Sequence, based on observed residues (ATOM records): (download)
    >2citA (A:)
    lkigawvgtqpsesaiksfqelqgrkldivhqfinwstdfswvrpyadavynngsilmit
    wepweyntvdikngkadayitrmaqdmkaygkeiwlrplhaangdwypwaigyssrvntn
    etyiaafrhivdifrangatnvkwvfnvncdnvgngtsylghypgdnyvdytsidgynwg
    ttqswgsqwqsfdqvfsrayqalasinkpiiiaefasaeiggnkarwiteaynsirtsyn
    kviaavwfhenketdwrinsspealaayreaiga