PDB entry 2cio

View 2cio on RCSB PDB site
Description: The high resolution x-ray structure of papain complexed with fragments of the Trypanosoma brucei cysteine protease inhibitor ICP.
Class: hydrolase/inhibitor
Keywords: HYDROLASE/INHIBITOR, COMPLEX HYDROLASE-INHIBITOR, ICP, CYSTEINE PROTEASE, INHIBITOR, TRYPANOSOMA BRUCEI, ALLERGEN, PROTEASE, THIOL PROTEASE, ZYMOGEN, HYDROLASE, HYDROLASE-INHIBITOR complex
Deposited on 2006-03-24, released 2006-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: papain
    Species: CARICA PAPAYA [TaxId:3649]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00784 (0-211)
      • conflict (46)
    Domains in SCOPe 2.08: d2cioa_
  • Chain 'B':
    Compound: inhibitor of cysteine peptidase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ciob_
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cioA (A:)
    ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlnqyseqelldcdrrs
    ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
    llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
    wgengyirikrgtgnsygvcglytssfypvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cioB (B:)
    mshnlfteednnktirmvigetftielesnpttgytwlrsglagtelsdctfaiqskfnn
    raphdnhknhrrllvgaggtmvlevkalkagkhtlslaygrpwvgfnaaakrynihveat
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cioB (B:)
    ggtlsla