PDB entry 2cie

View 2cie on RCSB PDB site
Description: complexes of dodecin with flavin and flavin-like ligands
Class: flavoprotein
Keywords: flavoprotein
Deposited on 2006-03-20, released 2006-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vng1446h
    Species: Halobacterium salinarium
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2ciea1
  • Heterogens: MG, NA, CL, SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cieA (A:)
    vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
    feld