PDB entry 2cie

View 2cie on RCSB PDB site
Description: complexes of dodecin with flavin and flavin-like ligands
Class: flavoprotein
Keywords: flavoprotein
Deposited on 2006-03-20, released 2006-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: vng1446h
  Species: HALOBACTERIUM SALINARIUM [TaxId:2242]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HPW4 (0-63)
  Domains in SCOPe 2.08: d2ciea_
• Heterogens: MG, NA, CL, SO4, FAD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cieA (A:)
  vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
  feld