PDB entry 2cic

View 2cic on RCSB PDB site
Description: the crystal structure of a complex of campylobacter jejuni dutpase with substrate analogue dupnhpp
Class: hydrolase
Keywords: ligand complex, hydrolase, drug target, dutp pyrophosphatase
Deposited on 2006-03-17, released 2007-03-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.162
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxyuridine 5'-triphosphate nucleotide hydrolase
    Species: Campylobacter jejuni [TaxId:197]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2cica_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cicA (A:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllleeyrdknnkdfkaiatevnavsvfqdfckeeey
    pnegdiygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlni
    frqnngykdgsykktwngkednevlaqileqeldfdtiykkleecykka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cicA (A:)
    mtnieilenmlklqqklndetnglnwengytkegkliswrrciymecaelidsftwkhwk
    nissltnwenvrieivdiwhfilsllleeydfkaiatevnavsvfqdfckeeeypnegdi
    ygilndieliihkcsgfgfnlgellstyftlaikcglnleilyktyigknvlnifrqnng
    ykdgsykktwngkednevlaqileqeldfdtiykkleecykka