PDB entry 2cia

View 2cia on RCSB PDB site
Description: human nck2 sh2-domain in complex with a decaphosphopeptide from translocated intimin receptor (tir) of epec
Class: sh2-domain
Keywords: sh2-domain, sh3 domain, phosphorylation, binding specificity
Deposited on 2006-03-17, released 2006-04-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.15
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytoplasmic protein NCK2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2CIA (Start-4)
  • Uniprot O43639 (5-101)
  Domains in SCOPe 2.03: d2ciaa_
• Chain 'L':
  Compound: translocated intimin receptor
  Species: Escherichia coli, synthetic [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • PDB 2CIA
  • Uniprot O50190 (0-End)
• Heterogens: MPD, IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ciaA (A:)
  gplgsewyygnvtrhqaecalnergvegdflirdsesspsdfsvslkasgknkhfkvqlv
  dnvycigqrrfhtmdelvehykkapiftsehgeklylvralq
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ciaA (A:)
  sewyygnvtrhqaecalnergvegdflirdsesspsdfsvslkasgknkhfkvqlvdnvy
  cigqrrfhtmdelvehykkapiftsehgeklylvralq
  

  
  
• Chain 'L':
  No sequence available.