PDB entry 2ci8

View 2ci8 on RCSB PDB site
Description: sh2 domain of human nck1 adaptor protein - uncomplexed
Class: translation
Keywords: translation, binding specificity, host-pathogen, interactions
Deposited on 2006-03-17, released 2006-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.232
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytoplasmic protein nck1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16333 (1-97)
    • expression tag (0)
    • expression tag (98)
  Domains in SCOPe 2.07: d2ci8a1, d2ci8a2, d2ci8a3
• Heterogens: SO4, 1PE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ci8A (A:)
  spwyygkvtrhqaemalnerghegdflirdsesspndfsvslkaqgknkhfkvqlketvy
  cigqrkfstmeelvehykkapiftseqgeklylvkhlss