PDB entry 2ci2

View 2ci2 on RCSB PDB site
Description: crystal and molecular structure of the serine proteinase inhibitor ci-2 from barley seeds
Class: proteinase inhibitor (chymotrypsin)
Keywords: proteinase inhibitor (chymotrypsin)
Deposited on 1988-09-05, released 1988-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'I':
  Compound: chymotrypsin inhibitor 2
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01053 (Start-82)
    • conflict (77)
  Domains in SCOPe 2.07: d2ci2i_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >2ci2I (I:)
  ssvekkpegvntgagdrhnlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtme
  yridrvrlfvdkldniaevprvg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ci2I (I:)
  nlktewpelvgksveeakkvilqdkpeaqiivlpvgtivtmeyridrvrlfvdkldniae
  vprvg