PDB entry 2chy

View 2chy on RCSB PDB site
Description: three-dimensional structure of chey, the response regulator of bacterial chemotaxis
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1990-05-17, released 1990-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.29
AEROSPACI score: -1.87 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chey
  Species: Salmonella typhimurium [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
    • conflict (54)
  Domains in SCOPe 2.07: d2chya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2chyA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiicdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm