PDB entry 2chy

View 2chy on RCSB PDB site
Description: three-dimensional structure of chey, the response regulator of bacterial chemotaxis
Deposited on 1990-05-17, released 1990-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.29
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2chy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2chy_ (-)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiicdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm