PDB entry 2chr

View 2chr on RCSB PDB site
Description:
Deposited on 1995-02-24, released 1995-07-31
The last revision prior to the SCOP 1.67 freeze date was dated 1999-03-19, with a file datestamp of 1999-03-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.189
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d2chr_1, d2chr_2

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2chr_ (-)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs