PDB entry 2chr

View 2chr on RCSB PDB site
Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
Class: isomerase
Keywords: isomerase
Deposited on 1995-02-24, released 1995-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.189
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloromuconate cycloisomerase
    Species: Cupriavidus necator [TaxId:106590]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2chra1, d2chra2
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2chrA (A:)
    mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
    etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
    aellggplrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmea
    lsnslgskaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrv
    aimadeslstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmld
    stigtsvalqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtlde
    dkvrqyarvs