PDB entry 2cho

View 2cho on RCSB PDB site
Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity
Class: hydrolase
Keywords: o-glcnacase, hydrolase, n-acetylglucosamine
Deposited on 2006-03-16, released 2006-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.182
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2choa1, d2choa2, d2choa3
  • Chain 'B':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2chob1, d2chob2, d2chob3
  • Chain 'C':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CHO (4-12)
  • Chain 'D':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CHO (4-12)
  • Heterogens: CA, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2choA (A:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdakewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2choA (A:)
    lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
    qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrgv
    vegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqelv
    avanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnpq
    kqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtgd
    rvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvtn
    pmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpng
    hgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpli
    veitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqp
    gvktatrvikplidrtfatvvkffnqkfnahldattdymphkmnlplqvkanrvlispve
    ieldaiypgeniqinfrlsaglqkapvkfvrfqfvltiekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2choB (B:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdakewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2choB (B:)
    lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
    qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrgv
    vegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqelv
    avanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnpq
    kqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtgd
    rvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvtn
    pmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpng
    hgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpli
    veitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqp
    gvktatrvikplidrtfatvvkffnqkfnahldattdymphkmnlplqvkanrvlispve
    ieldaiypgeniqinfrlsaglqkapvkfvrffvltiek
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.