PDB entry 2chn

View 2chn on RCSB PDB site
Description: Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity- NAG-thiazoline complex
Class: hydrolase
Keywords: o-glcnacase, hydrolase, n-acetylglucosamibe
Deposited on 2006-03-15, released 2006-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2chna1, d2chna2, d2chna3
  • Chain 'B':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2chnb1, d2chnb2, d2chnb3
  • Chain 'C':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CHN (4-11)
  • Chain 'D':
    Compound: glucosaminidase
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CHN (4-11)
  • Heterogens: CA, NGT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chnA (A:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdakewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chnA (A:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkys
    rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrg
    vvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqel
    vavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnp
    qkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtg
    drvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvt
    npmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpn
    ghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpl
    iveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyq
    pgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmnlplqvkanrvlispv
    eieldaiypgeniqinfrlsaglqkapvkfvrfqfvltiekk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2chnB (B:)
    qnvslqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisig
    ekgdksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeve
    ikdypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpy
    pdkeaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavf
    fddisgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdk
    lnpsiqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndt
    tiakemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelec
    famhnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesad
    illmntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfy
    idqtsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmisnve
    qiknlplqvkanrvlispanevvkwaagnsveieldaiypgeniqinfgkdapctwgrle
    istdakewktvdlkqkesrlsaglqkapvkfvrftnvsdeeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chnB (B:)
    lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
    qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdypsvryrgv
    vegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaaqlqelv
    avanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisgegtnpq
    kqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiqimwtgd
    rvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakemsgfvtn
    pmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhnsdlgpng
    hgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpli
    veitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqp
    gvktatrvikplidrtfatvvkffnqkfnahldattdymphkmnlplqvkanrvlispve
    ieldaiypgeniqinfrlsaglqkapvkfvrffvltiek
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.