PDB entry 2chl

View 2chl on RCSB PDB site
Description: Structure of casein kinase 1 gamma 3
Class: transferase
Keywords: transferase, serine/threonine kinase, ATP-binding, wnt signaling pathway, kinase, nucleotide-binding, phosphorylation, serine/threonine-protein kinase
Deposited on 2006-03-15, released 2006-03-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.186
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase I isoform gamma-3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6M4
      • conflict (175)
    Domains in SCOPe 2.05: d2chla_
  • Heterogens: DKI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chlA (A:)
    mhhhhhhssgvdlgtenlyfqsmgvlmvgpnfrvgkkigcgnfgelrlgknlytneyvai
    klepmksrapqlhleyrfykqlgsgdgipqvyyfgpcgkynamvlellgpsledlfdlcd
    rtfslktvlmiaiqlisrmeyvhsknliyrdvkpenfligrpgnktqqvihiidfalake
    yidpetkkhipyrehksltgtarymsinthlgkeqsrrddlealghmfmyflrgslpwqg
    lkadtlkeryqkigdtkratpievlcenfpematylryvrrldffekpdydylrklftdl
    fdrkgymfdyeydwigkqlptpvgavqqdpalssnreahqhrdkmqqsknq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chlA (A:)
    vlmvgpnfrvgkkigcgnfgelrlgknlytneyvaiklepmksrapqlhleyrfykqlgs
    gdgipqvyyfgpcgkynamvlellgpsledlfdlcdrtfslktvlmiaiqlisrmeyvhs
    knliyrdvkpenfligrpgnktqqvihiidfalakeyidpetkkhipyrehksltgtary
    msinthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpiev
    lcenfpematylryvrrldffekpdydylrklftdlfdrkgymfdyeydwigkqlptp