PDB entry 2che

View 2che on RCSB PDB site
Description: structure of the mg2+-bound form of chey and mechanism of phosphoryl transfer in bacterial chemotaxis
Class: signal transduction protein
Keywords: signal transduction protein
Deposited on 1994-01-17, released 1994-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: chey
  Species: Salmonella typhimurium [TaxId:602]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
  Domains in SCOPe 2.07: d2chea_
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cheA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm