PDB entry 2chd

View 2chd on RCSB PDB site
Description: crystal structure of the c2a domain of rabphilin-3a
Class: protein transport
Keywords: rabphilin-3a, c2 domain, c2a, calcium binding, synaptic exocytosis, metal-binding, protein transport, synapse, transport, zinc-finger
Deposited on 2006-03-14, released 2006-06-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rabphilin-3a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CHD
    • Uniprot P47709 (Start-141)
    Domains in SCOPe 2.07: d2chda_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2chdA (A:)
    gseansydsdqattlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllp
    gasksnklrtktlrntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetr
    fslkklkanqrknfniclervi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chdA (A:)
    tlgalefsllydqdnsnlqctiirakglkpmdsngladpyvklhllpgasksnklrtktl
    rntrnpvwnetlqyhgiteedmqrktlrisvcdedkfghnefigetrfslkklkanqrkn
    fniclervi