PDB entry 2chb

View 2chb on RCSB PDB site
Description: cholera toxin b-pentamer complexed with gm1 pentasaccharide
Deposited on 1997-06-03, released 1997-12-03
The last revision prior to the SCOP 1.67 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.67: d2chbd_
  • Chain 'E':
    Domains in SCOP 1.67: d2chbe_
  • Chain 'F':
    Domains in SCOP 1.67: d2chbf_
  • Chain 'G':
    Domains in SCOP 1.67: d2chbg_
  • Chain 'H':
    Domains in SCOP 1.67: d2chbh_

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2chbD (D:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chbD (D:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2chbE (E:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chbE (E:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2chbF (F:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chbF (F:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2chbG (G:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chbG (G:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2chbH (H:)
    mtpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhid
    sqkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
    

    Sequence, based on observed residues (ATOM records): (download)
    >2chbH (H:)
    tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
    qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman