PDB entry 2cha

View 2cha on RCSB PDB site
Description: the structure of crystalline alpha-chymotrypsin, $v.the atomic structure of tosyl-alpha-chymotrypsin at 2 angstroms resolution
Deposited on 1975-01-01, released 1977-01-18
The last revision prior to the SCOP 1.55 freeze date was dated 1984-05-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2cha__
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2cha_ (-)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cha_ (-)
    cgvpaiqpvivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvv
    vagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
    sddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.