PDB entry 2ch4

View 2ch4 on RCSB PDB site
Description: complex between bacterial chemotaxis histidine kinase chea domains p4 and p5 and receptor-adaptor protein chew
Class: transferase/chemotaxis
Keywords: transferase/chemotaxis, chemotaxis, protein-protein complex, signal transduction, histidine kinase, sensory transduction, phosphorylation, transferase
Deposited on 2006-03-10, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.255
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CH4 (0-2)
    • Uniprot Q56310 (3-319)
    Domains in SCOPe 2.07: d2ch4a1, d2ch4a2, d2ch4a3
  • Chain 'B':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CH4 (Start-2)
    • Uniprot Q56310 (3-319)
    Domains in SCOPe 2.07: d2ch4b1, d2ch4b2, d2ch4b3
  • Chain 'W':
    Compound: chemotaxis protein chew
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ch4w1
  • Chain 'Y':
    Compound: chemotaxis protein chew
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ch4y1
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ch4A (A:)
    gshmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnai
    dhgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglide
    skaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgt
    kvtirlpltlaiiqallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevip
    vyrlwevlqiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefs
    gaailgdgsialiinvsgiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ch4B (B:)
    gshmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnai
    dhgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglide
    skaatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgt
    kvtirlpltlaiiqallvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevip
    vyrlwevlqiehkeeleemeavivrvgnrkygivvddllgqddivikslgkvfsevkefs
    gaailgdgsialiinvsgiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch4B (B:)
    shmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaid
    hgiepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglides
    kaatlsdqeilnflfvpgfsmdvvknvveslngsisiesekdkgtkvtirlpltlaiiqa
    llvkvnnlvyaipianidtilsiskediqrvqdrdvivirgevipvyrlwevlqiehkee
    leemeavivrvgnrkygivvddllgqddivikslgkvfsevkefsgaailgdgsialiin
    vsgiv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2ch4W (W:)
    mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii
    pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk
    kskglvktdgrliiyldidkiieeitvkegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch4W (W:)
    kefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgriipvvnlaki
    lgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgkkskglvkt
    dgrliiyldidkiieeitv
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2ch4Y (Y:)
    mktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgrii
    pvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgk
    kskglvktdgrliiyldidkiieeitvkegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ch4Y (Y:)
    lkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgriipvvnlak
    ilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgkkskglvk
    tdgrliiyldidkiieeitv